Recombinant Human NFKBIE, His-tagged
Cat.No. : | NFKBIE-28876TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 319-500 of Human IKB epsilon with N terminal His tag; 182 amino acids, 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 319-500 a.a. |
Description : | The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, which activates NF-kappa-B by making it available to translocate to the nucleus. |
Conjugation : | HIS |
Tissue specificity : | Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages. |
Form : | Lyophilised:Reconstitute with 92 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTS HSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADI DVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLN GCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQ DLTEESLVLLPFDDLKISGKLLLCTD |
Sequence Similarities : | Belongs to the NF-kappa-B inhibitor family.Contains 6 ANK repeats. |
Gene Name | NFKBIE nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon [ Homo sapiens ] |
Official Symbol | NFKBIE |
Synonyms | NFKBIE; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon; NF-kappa-B inhibitor epsilon; IKBE; |
Gene ID | 4794 |
mRNA Refseq | NM_004556 |
Protein Refseq | NP_004547 |
MIM | 604548 |
Uniprot ID | O00221 |
Chromosome Location | 6p21.1 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; |
◆ Recombinant Proteins | ||
NFKBIE-232H | Recombinant Human NFKBIE protein, His-tagged | +Inquiry |
NFKBIE-28876TH | Recombinant Human NFKBIE, His-tagged | +Inquiry |
NFKBIE-4697H | Recombinant Human NFKBIE Protein (Arg207-Pro440), N-His tagged | +Inquiry |
Nfkbie-1301M | Recombinant Mouse Nfkbie protein, His & T7-tagged | +Inquiry |
NFKBIE-001H | Recombinant Human NFKB inhibitor epsilon Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFKBIE Products
Required fields are marked with *
My Review for All NFKBIE Products
Required fields are marked with *
0
Inquiry Basket