Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NFKBIE, His-tagged

Cat.No. : NFKBIE-28876TH
Product Overview : Recombinant fragment, corresponding to amino acids 319-500 of Human IKB epsilon with N terminal His tag; 182 amino acids, 22kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, which activates NF-kappa-B by making it available to translocate to the nucleus.
Conjugation : HIS
Source : E. coli
Tissue specificity : Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages.
Form : Lyophilised:Reconstitute with 92 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTS HSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADI DVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLN GCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQ DLTEESLVLLPFDDLKISGKLLLCTD
Sequence Similarities : Belongs to the NF-kappa-B inhibitor family.Contains 6 ANK repeats.
Gene Name : NFKBIE nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon [ Homo sapiens ]
Official Symbol : NFKBIE
Synonyms : NFKBIE; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon; NF-kappa-B inhibitor epsilon; IKBE;
Gene ID : 4794
mRNA Refseq : NM_004556
Protein Refseq : NP_004547
MIM : 604548
Uniprot ID : O00221
Chromosome Location : 6p21.1
Pathway : Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends