Recombinant Human NFKBIZ protein, GST-tagged

Species :	Human
Source :	E.coli
Tag :	GST
Protein Length :	369-718 aa
Form :	The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence :	AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Name	NFKBIZ nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta [ Homo sapiens ]
Official Symbol	NFKBIZ
Synonyms	NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; NF-kappa-B inhibitor zeta; FLJ34463; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; Ikappa B-zeta variant 3; IL-1 inducible nuclear ankyrin-repeat protein; molecule possessing ankyrin repeats induced by lipopolysaccharide; IKBZ; INAP; FLJ30225;
Gene ID	64332
mRNA Refseq	NM_001005474
Protein Refseq	NP_001005474
MIM	608004
UniProt ID	Q9BYH8