Recombinant Human NFKBIZ protein, GST-tagged
| Cat.No. : | NFKBIZ-458H |
| Product Overview : | Recombinant Human NFKBIZ protein(369-718 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 369-718 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NFKBIZ nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta [ Homo sapiens ] |
| Official Symbol | NFKBIZ |
| Synonyms | NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; NF-kappa-B inhibitor zeta; FLJ34463; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; Ikappa B-zeta variant 3; IL-1 inducible nuclear ankyrin-repeat protein; molecule possessing ankyrin repeats induced by lipopolysaccharide; IKBZ; INAP; FLJ30225; |
| Gene ID | 64332 |
| mRNA Refseq | NM_001005474 |
| Protein Refseq | NP_001005474 |
| MIM | 608004 |
| UniProt ID | Q9BYH8 |
| ◆ Recombinant Proteins | ||
| NFKBIZ-451H | Recombinant Human NFKBIZ Protein, His-tagged | +Inquiry |
| NFKBIZ-458H | Recombinant Human NFKBIZ protein, GST-tagged | +Inquiry |
| Nfkbiz-452M | Recombinant Mouse Nfkbiz Protein, His-tagged | +Inquiry |
| NFKBIZ-1401C | Recombinant Chicken NFKBIZ | +Inquiry |
| NFKBIZ-6043M | Recombinant Mouse NFKBIZ Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFKBIZ-3845HCL | Recombinant Human NFKBIZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKBIZ Products
Required fields are marked with *
My Review for All NFKBIZ Products
Required fields are marked with *
