Recombinant Human NFKBIZ protein, GST-tagged

• Cat.No.: NFKBIZ-458H
• Product Overview: Recombinant Human NFKBIZ protein(369-718 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 369-718 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NFKBIZ nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta [ Homo sapiens ]
• Official Symbol: NFKBIZ
• Synonyms: NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; NF-kappa-B inhibitor zeta; FLJ34463; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; Ikappa B-zeta variant 3; IL-1 inducible nuclear ankyrin-repeat protein; molecule possessing ankyrin repeats induced by lipopolysaccharide; IKBZ; INAP; FLJ30225
• Gene ID: 64332
• mRNA Refseq: NM_001005474
• Protein Refseq: NP_001005474
• MIM: 608004
• UniProt ID: Q9BYH8