Recombinant Human NFKBIZ protein, GST-tagged
Cat.No. : | NFKBIZ-458H |
Product Overview : | Recombinant Human NFKBIZ protein(NP_001005474)(369-718 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 369-718 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NFKBIZ nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta [ Homo sapiens ] |
Official Symbol | NFKBIZ |
Synonyms | NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; NF-kappa-B inhibitor zeta; FLJ34463; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; Ikappa B-zeta variant 3; IL-1 inducible nuclear ankyrin-repeat protein; molecule possessing ankyrin repeats induced by lipopolysaccharide; IKBZ; INAP; FLJ30225; |
Gene ID | 64332 |
mRNA Refseq | NM_001005474 |
Protein Refseq | NP_001005474 |
MIM | 608004 |
UniProt ID | Q9BYH8 |
◆ Recombinant Proteins | ||
NFKBIZ-458H | Recombinant Human NFKBIZ protein, GST-tagged | +Inquiry |
NFKBIZ-6043M | Recombinant Mouse NFKBIZ Protein, His (Fc)-Avi-tagged | +Inquiry |
NFKBIZ-1401C | Recombinant Chicken NFKBIZ | +Inquiry |
NFKBIZ-451H | Recombinant Human NFKBIZ Protein, His-tagged | +Inquiry |
NFKBIZ-10629M | Recombinant Mouse NFKBIZ Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKBIZ-3845HCL | Recombinant Human NFKBIZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKBIZ Products
Required fields are marked with *
My Review for All NFKBIZ Products
Required fields are marked with *
0
Inquiry Basket