Recombinant Human NFYC
Cat.No. : | NFYC-29920TH |
Product Overview : | Recombinant fragment of Human NFYC with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF |
Sequence Similarities : | Belongs to the NFYC/HAP5 subunit family. |
Gene Name | NFYC nuclear transcription factor Y, gamma [ Homo sapiens ] |
Official Symbol | NFYC |
Synonyms | NFYC; nuclear transcription factor Y, gamma; nuclear transcription factor Y subunit gamma; CBF C; NF YC; |
Gene ID | 4802 |
mRNA Refseq | NM_001142587 |
Protein Refseq | NP_001136059 |
MIM | 605344 |
Uniprot ID | Q13952 |
Chromosome Location | 1p32 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFYC-29920TH | Recombinant Human NFYC | +Inquiry |
NFYC-3638R | Recombinant Rat NFYC Protein, His (Fc)-Avi-tagged | +Inquiry |
Nfyc-4403M | Recombinant Mouse Nfyc Protein, Myc/DDK-tagged | +Inquiry |
Nfyc-5145M | Recombinant Mouse Nfyc protein | +Inquiry |
NFYC-3979R | Recombinant Rat NFYC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYC-3838HCL | Recombinant Human NFYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFYC Products
Required fields are marked with *
My Review for All NFYC Products
Required fields are marked with *