Recombinant Human NGFRAP1 Protein (1-111 aa), GST-tagged
| Cat.No. : | NGFRAP1-684H |
| Product Overview : | Recombinant Human NGFRAP1 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-111 aa |
| Description : | May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 40.0 kDa |
| AA Sequence : | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NGFRAP1 nerve growth factor receptor (TNFRSF16) associated protein 1 [ Homo sapiens ] |
| Official Symbol | NGFRAP1 |
| Synonyms | NGFRAP1; protein BEX3; Bex; BEX3; brain expressed; X linked 3; DXS6984E; HGR74; NADE; |
| Gene ID | 27018 |
| mRNA Refseq | NM_014380 |
| Protein Refseq | NP_055195 |
| MIM | 300361 |
| UniProt ID | Q00994 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGFRAP1 Products
Required fields are marked with *
My Review for All NGFRAP1 Products
Required fields are marked with *
