Recombinant Human NGFRAP1 Protein (1-111 aa), GST-tagged
Cat.No. : | NGFRAP1-684H |
Product Overview : | Recombinant Human NGFRAP1 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-111 aa |
Description : | May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.0 kDa |
AA Sequence : | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NGFRAP1 nerve growth factor receptor (TNFRSF16) associated protein 1 [ Homo sapiens ] |
Official Symbol | NGFRAP1 |
Synonyms | NGFRAP1; protein BEX3; Bex; BEX3; brain expressed; X linked 3; DXS6984E; HGR74; NADE; |
Gene ID | 27018 |
mRNA Refseq | NM_014380 |
Protein Refseq | NP_055195 |
MIM | 300361 |
UniProt ID | Q00994 |
◆ Recombinant Proteins | ||
NGFRAP1-3023R | Recombinant Rhesus monkey NGFRAP1 Protein, His-tagged | +Inquiry |
NGFRAP1-10642M | Recombinant Mouse NGFRAP1 Protein | +Inquiry |
NGFRAP1-684H | Recombinant Human NGFRAP1 Protein (1-111 aa), GST-tagged | +Inquiry |
Ngfrap1-1830R | Recombinant Rat Ngfrap1 Protein, His-tagged | +Inquiry |
NGFRAP1-6049M | Recombinant Mouse NGFRAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGFRAP1-1191HCL | Recombinant Human NGFRAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGFRAP1 Products
Required fields are marked with *
My Review for All NGFRAP1 Products
Required fields are marked with *