Recombinant Human NHE1 protein, His-tagged
Cat.No. : | NHE1-3792H |
Product Overview : | Recombinant Human NHE1 protein(1-108 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-108 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC9A1 solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 [ Homo sapiens (human) ] |
Official Symbol | NHE1 |
Synonyms | SLC9A1; APNH; NHE1; NHE-1; solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1; sodium/hydrogen exchanger 1; Na(+)/H(+) exchanger 1; Na-Li countertransporter; solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, Na+/H+, amiloride sensitive) |
Gene ID | 6548 |
mRNA Refseq | NM_003047 |
Protein Refseq | NP_003038 |
MIM | 107310 |
UniProt ID | P19634 |
◆ Recombinant Proteins | ||
NHE1-3792H | Recombinant Human NHE1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHE1 Products
Required fields are marked with *
My Review for All NHE1 Products
Required fields are marked with *