Recombinant Human NHE1 protein, His-tagged

Cat.No. : NHE1-3792H
Product Overview : Recombinant Human NHE1 protein(1-108 aa), fused to His tag, was expressed in E. coli.
Availability September 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-108 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC9A1 solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 [ Homo sapiens (human) ]
Official Symbol NHE1
Synonyms SLC9A1; APNH; NHE1; NHE-1; solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1; sodium/hydrogen exchanger 1; Na(+)/H(+) exchanger 1; Na-Li countertransporter; solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, Na+/H+, amiloride sensitive)
Gene ID 6548
mRNA Refseq NM_003047
Protein Refseq NP_003038
MIM 107310
UniProt ID P19634

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NHE1 Products

Required fields are marked with *

My Review for All NHE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon