Recombinant Human NHP2L1, His-tagged
Cat.No. : | NHP2L1-28304TH |
Product Overview : | Recombinant full length Human NHP2L1 with an N terminal His tag; 152 amino acids with tag, MWt 16.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 128 amino acids |
Description : | Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the |
Conjugation : | HIS |
Molecular Weight : | 16.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
Gene Name | NHP2L1 NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NHP2L1 |
Synonyms | NHP2L1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); non histone chromosome protein 2 (S. cerevisiae) like 1 , sperm specific antigen 1 , SSFA1; NHP2-like protein 1; 15.5K; FA 1; small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP1 |
Gene ID | 4809 |
mRNA Refseq | NM_001003796 |
Protein Refseq | NP_001003796 |
MIM | 601304 |
Uniprot ID | P55769 |
Chromosome Location | 22q13 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; |
Function | RNA binding; protein binding; contributes_to snoRNA binding; |
◆ Recombinant Proteins | ||
NHP2L1-2950H | Recombinant Human NHP2L1, His-tagged | +Inquiry |
NHP2L1-10655M | Recombinant Mouse NHP2L1 Protein | +Inquiry |
NHP2L1-746C | Recombinant Cynomolgus NHP2L1 Protein, His-tagged | +Inquiry |
NHP2L1-3644R | Recombinant Rat NHP2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NHP2L1-490C | Recombinant Cynomolgus Monkey NHP2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHP2L1 Products
Required fields are marked with *
My Review for All NHP2L1 Products
Required fields are marked with *
0
Inquiry Basket