Recombinant Human NHP2L1, His-tagged
| Cat.No. : | NHP2L1-28304TH |
| Product Overview : | Recombinant full length Human NHP2L1 with an N terminal His tag; 152 amino acids with tag, MWt 16.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 128 amino acids |
| Description : | Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the |
| Conjugation : | HIS |
| Molecular Weight : | 16.700kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
| Gene Name | NHP2L1 NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NHP2L1 |
| Synonyms | NHP2L1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); non histone chromosome protein 2 (S. cerevisiae) like 1 , sperm specific antigen 1 , SSFA1; NHP2-like protein 1; 15.5K; FA 1; small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP1 |
| Gene ID | 4809 |
| mRNA Refseq | NM_001003796 |
| Protein Refseq | NP_001003796 |
| MIM | 601304 |
| Uniprot ID | P55769 |
| Chromosome Location | 22q13 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; |
| Function | RNA binding; protein binding; contributes_to snoRNA binding; |
| ◆ Recombinant Proteins | ||
| NHP2L1-10655M | Recombinant Mouse NHP2L1 Protein | +Inquiry |
| NHP2L1-3644R | Recombinant Rat NHP2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NHP2L1-746C | Recombinant Cynomolgus NHP2L1 Protein, His-tagged | +Inquiry |
| NHP2L1-2950H | Recombinant Human NHP2L1, His-tagged | +Inquiry |
| NHP2L1-782H | Recombinant Human NHP2L1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHP2L1 Products
Required fields are marked with *
My Review for All NHP2L1 Products
Required fields are marked with *
