Recombinant Human NHP2L1, His-tagged

Cat.No. : NHP2L1-28304TH
Product Overview : Recombinant full length Human NHP2L1 with an N terminal His tag; 152 amino acids with tag, MWt 16.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 128 amino acids
Description : Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the
Conjugation : HIS
Molecular Weight : 16.700kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Gene Name NHP2L1 NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol NHP2L1
Synonyms NHP2L1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); non histone chromosome protein 2 (S. cerevisiae) like 1 , sperm specific antigen 1 , SSFA1; NHP2-like protein 1; 15.5K; FA 1; small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP1
Gene ID 4809
mRNA Refseq NM_001003796
Protein Refseq NP_001003796
MIM 601304
Uniprot ID P55769
Chromosome Location 22q13
Pathway Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function RNA binding; protein binding; contributes_to snoRNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NHP2L1 Products

Required fields are marked with *

My Review for All NHP2L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon