Active Recombinant Human NNMT Protein, His tagged

• Cat.No.: NNMT-143H
• Product Overview: Recombinant human NNMT protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-264 aa
• Description: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.
• Form: Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
• Bio-activity: Specific activity is > 100 nmol/min/mg, and is defined as the amount of enzyme that transfer 1.0 nmole of methyl group per minute at 37 centigrade.
• Molecular Mass: 37.7 kDa (284aa) confirmed by MALDI-TOF
• AASequence: MGSSHHHHHHSSGLVPRGSHMESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
• Purity: > 95% by SDS-PAGE
• Applications: Enzyme Activity,SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Publications:
  Noncompetitive Inhibition of Indolethylamine N-Methyltransferase by N, N Dimethyltryptamine (DMT) and N, N-Dimethylaminopropyltryptamine (2014)

Gene Information

• Gene Name: NNMT nicotinamide N-methyltransferase [ Homo sapiens (human) ]
• Official Symbol: NNMT
• Synonyms: NNMT; nicotinamide N-methyltransferase
• Gene ID: 4837
• mRNA Refseq: NM_006169
• Protein Refseq: NP_006160
• MIM: 600008
• UniProt ID: P40261

Citation

Noncompetitive Inhibition of Indolethylamine- N -methyltransferase by N , N -Dimethyltryptamine and N , N -Dimethylaminopropyltryptamine

Journal: Biochemistry    PubMed ID: 24730580    Data: 2015/4/14

Authors: Uyen B. Chu, Sevahn K. Vorperian, Arnold E. Ruoho

Article Snippet:Histidine-tagged human indolethylamine- N -methyltransferase was obtained from the Structural Genomics Consortium (University of Toronto, Toronto, ON).Histidine-tagged human indolethylamine- N -methyltransferase was obtained from the Structural Genomics Consortium (University of Toronto, Toronto, ON).. Recombinant human phenylethanolamine- N -methyltransferase (hPNMT) and nicotinamide- N -methyltransferase (hNNMT) were purchased from Creative BioMart (Shirley, NY).. All reagents for the hPNMT assay were prepared in 50 mM Tris-HCl buffer (pH 8.5) unless stated otherwise, excluding PDAT, which was dissolved in dimethyl sulfoxide (DMSO).All reagents for the hPNMT assay were prepared in 50 mM Tris-HCl buffer (pH 8.5) unless stated otherwise, excluding PDAT, which was dissolved in dimethyl sulfoxide (DMSO).