Recombinant Human NIF3L1, His-tagged
| Cat.No. : | NIF3L1-27231TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 101-350 of Human ALS2CR1 with N terminal His tag; Predicted MWt 28 kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 101-350 a.a. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 93 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | TAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNH RVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEE QTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSLEKP LLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLA LGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSH HDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLE NKINIILSETDRDPLQVV | 
| Sequence Similarities : | Belongs to the UPF0135 (NIF3) family. | 
| Gene Name | NIF3L1 NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | NIF3L1 | 
| Synonyms | NIF3L1; NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae); ALS2CR1, NIF3 (Ngg1 interacting factor 3, S.pombe homolog) like 1 , NIF3 NGG1 interacting factor 3 like 1 (S. pombe); NIF3-like protein 1; CALS 7; MDS015; | 
| Gene ID | 60491 | 
| mRNA Refseq | NM_001136039 | 
| Protein Refseq | NP_001129511 | 
| MIM | 605778 | 
| Uniprot ID | Q9GZT8 | 
| Chromosome Location | 2q33 | 
| Function | protein binding; transcription factor binding; | 
| ◆ Recombinant Proteins | ||
| NIF3L1-10663M | Recombinant Mouse NIF3L1 Protein | +Inquiry | 
| NIF3L1-3195Z | Recombinant Zebrafish NIF3L1 | +Inquiry | 
| NIF3L1-6064M | Recombinant Mouse NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NIF3L1-5995H | Recombinant Human NIF3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| NIF3L1-3028R | Recombinant Rhesus monkey NIF3L1 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NIF3L1-3828HCL | Recombinant Human NIF3L1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NIF3L1 Products
Required fields are marked with *
My Review for All NIF3L1 Products
Required fields are marked with *
  
        
    
      
            