Recombinant Human NIF3L1, His-tagged
Cat.No. : | NIF3L1-27231TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 101-350 of Human ALS2CR1 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-350 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 93 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNH RVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEE QTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSLEKP LLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLA LGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSH HDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLE NKINIILSETDRDPLQVV |
Sequence Similarities : | Belongs to the UPF0135 (NIF3) family. |
Gene Name | NIF3L1 NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NIF3L1 |
Synonyms | NIF3L1; NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae); ALS2CR1, NIF3 (Ngg1 interacting factor 3, S.pombe homolog) like 1 , NIF3 NGG1 interacting factor 3 like 1 (S. pombe); NIF3-like protein 1; CALS 7; MDS015; |
Gene ID | 60491 |
mRNA Refseq | NM_001136039 |
Protein Refseq | NP_001129511 |
MIM | 605778 |
Uniprot ID | Q9GZT8 |
Chromosome Location | 2q33 |
Function | protein binding; transcription factor binding; |
◆ Recombinant Proteins | ||
NIF3L1-10663M | Recombinant Mouse NIF3L1 Protein | +Inquiry |
NIF3L1-3195Z | Recombinant Zebrafish NIF3L1 | +Inquiry |
NIF3L1-6064M | Recombinant Mouse NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIF3L1-5995H | Recombinant Human NIF3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NIF3L1-3028R | Recombinant Rhesus monkey NIF3L1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIF3L1-3828HCL | Recombinant Human NIF3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIF3L1 Products
Required fields are marked with *
My Review for All NIF3L1 Products
Required fields are marked with *