Recombinant Human NIF3L1, His-tagged
| Cat.No. : | NIF3L1-27231TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 101-350 of Human ALS2CR1 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-350 a.a. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 93 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNH RVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEE QTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSLEKP LLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLA LGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSH HDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLE NKINIILSETDRDPLQVV |
| Sequence Similarities : | Belongs to the UPF0135 (NIF3) family. |
| Gene Name | NIF3L1 NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NIF3L1 |
| Synonyms | NIF3L1; NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae); ALS2CR1, NIF3 (Ngg1 interacting factor 3, S.pombe homolog) like 1 , NIF3 NGG1 interacting factor 3 like 1 (S. pombe); NIF3-like protein 1; CALS 7; MDS015; |
| Gene ID | 60491 |
| mRNA Refseq | NM_001136039 |
| Protein Refseq | NP_001129511 |
| MIM | 605778 |
| Uniprot ID | Q9GZT8 |
| Chromosome Location | 2q33 |
| Function | protein binding; transcription factor binding; |
| ◆ Recombinant Proteins | ||
| NIF3L1-747C | Recombinant Cynomolgus NIF3L1 Protein, His-tagged | +Inquiry |
| NIF3L1-27231TH | Recombinant Human NIF3L1, His-tagged | +Inquiry |
| NIF3L1-1859H | Recombinant Human NIF3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NIF3L1-491C | Recombinant Cynomolgus Monkey NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NIF3L1-2847R | Recombinant Rhesus Macaque NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NIF3L1-3828HCL | Recombinant Human NIF3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIF3L1 Products
Required fields are marked with *
My Review for All NIF3L1 Products
Required fields are marked with *
