Recombinant Human NKAIN2 protein, GST-tagged
Cat.No. : | NKAIN2-1298H |
Product Overview : | Recombinant Human NKAIN2 protein(112-163 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 112-163 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | PGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | NKAIN2 |
Synonyms | NKAIN2; TCBA; TCBA1; FAM77B; NKAIP2; Na+/K+ transporting ATPase interacting 2; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; T-cell lymphoma breakpoint-associated target protein 1; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2 |
Gene ID | 154215 |
mRNA Refseq | NM_001040214 |
Protein Refseq | NP_001035304 |
MIM | 609758 |
UniProt ID | Q5VXU1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKAIN2 Products
Required fields are marked with *
My Review for All NKAIN2 Products
Required fields are marked with *
0
Inquiry Basket