Recombinant Human NKAIN2 protein, GST-tagged
| Cat.No. : | NKAIN2-1298H |
| Product Overview : | Recombinant Human NKAIN2 protein(112-163 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | August 21, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 112-163 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | PGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | NKAIN2 |
| Synonyms | NKAIN2; TCBA; TCBA1; FAM77B; NKAIP2; Na+/K+ transporting ATPase interacting 2; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; T-cell lymphoma breakpoint-associated target protein 1; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2 |
| Gene ID | 154215 |
| mRNA Refseq | NM_001040214 |
| Protein Refseq | NP_001035304 |
| MIM | 609758 |
| UniProt ID | Q5VXU1 |
| ◆ Recombinant Proteins | ||
| NKAIN2-6647HF | Recombinant Full Length Human NKAIN2 Protein, GST-tagged | +Inquiry |
| NKAIN2-10684M | Recombinant Mouse NKAIN2 Protein | +Inquiry |
| RFL21042HF | Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein 2(Nkain2) Protein, His-Tagged | +Inquiry |
| NKAIN2-5186C | Recombinant Chicken NKAIN2 | +Inquiry |
| NKAIN2-6080M | Recombinant Mouse NKAIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKAIN2 Products
Required fields are marked with *
My Review for All NKAIN2 Products
Required fields are marked with *



