Recombinant Human NKIRAS2 Protein, GST-tagged

Cat.No. : NKIRAS2-5891H
Product Overview : Human NKIRAS2 full-length ORF ( AAH07450, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NKIRAS2 (NFKB Inhibitor Interacting Ras Like 2) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS1.
Molecular Mass : 46.75 kDa
AA Sequence : MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ]
Official Symbol NKIRAS2
Synonyms NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; kappa B-Ras protein 2; I-kappa-B-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like protein 2; kappaB-Ras2; MGC74742; DKFZp434N1526;
Gene ID 28511
mRNA Refseq NM_001001349
Protein Refseq NP_001001349
MIM 604497
UniProt ID Q9NYR9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKIRAS2 Products

Required fields are marked with *

My Review for All NKIRAS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon