Recombinant Human NKIRAS2 Protein, GST-tagged
| Cat.No. : | NKIRAS2-5891H |
| Product Overview : | Human NKIRAS2 full-length ORF ( AAH07450, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NKIRAS2 (NFKB Inhibitor Interacting Ras Like 2) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS1. |
| Molecular Mass : | 46.75 kDa |
| AA Sequence : | MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ] |
| Official Symbol | NKIRAS2 |
| Synonyms | NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; kappa B-Ras protein 2; I-kappa-B-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like protein 2; kappaB-Ras2; MGC74742; DKFZp434N1526; |
| Gene ID | 28511 |
| mRNA Refseq | NM_001001349 |
| Protein Refseq | NP_001001349 |
| MIM | 604497 |
| UniProt ID | Q9NYR9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKIRAS2 Products
Required fields are marked with *
My Review for All NKIRAS2 Products
Required fields are marked with *



