Recombinant Human NKX2-1 Protein, GST-tagged

Cat.No. : NKX2-1-01H
Product Overview : Recombinant human NKX2-1 (1-371) protein with a N-terminal GST-tag was expressed in Wheat Germ(in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-371
Description : This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.
Molecular Mass : 65 kDa
AA Sequence : MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Applications : AP, Array, ELISA, WB-Re
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Warning : Wash thoroughly after handling. Use with adequate ventilation. Avoid contact with eyes, skin, and clothing. Avoid ingestion and inhalation.
Gene Name NKX2-1 NK2 homeobox 1 [ Homo sapiens (human) ]
Official Symbol NKX2-1
Synonyms NKX2-1; NK2 homeobox 1; BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1; homeobox protein Nkx-2.1; NK-2 homolog A; homeobox protein NK-2 homolog A; thyroid nuclear factor 1; thyroid transcription factor 1; thyroid-specific enhancer-binding protein
Gene ID 7080
mRNA Refseq NM_001079668
Protein Refseq NP_001073136
MIM 600635
UniProt ID P43699

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-1 Products

Required fields are marked with *

My Review for All NKX2-1 Products

Required fields are marked with *

0
cart-icon