Recombinant Human NKX2-3 protein, GST-tagged
Cat.No. : | NKX2-3-301372H |
Product Overview : | Recombinant Human NKX2-3 (19-148 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn19-Arg148 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NKX2-3 NK2 homeobox 3 [ Homo sapiens ] |
Official Symbol | NKX2-3 |
Synonyms | NKX2-3; NK2 homeobox 3; NK 2 (Drosophila) homolog C , NK2 transcription factor related, locus 3 (Drosophila) , NKX2C; homeobox protein Nkx-2.3; CSX3; NKX2.3; NKX4 3; homeobox protein NK-2 homolog C; NK2 transcription factor related, locus 3; NK2.3; NKX2C; NKX4-3; |
Gene ID | 159296 |
mRNA Refseq | NM_145285 |
Protein Refseq | NP_660328 |
MIM | 606727 |
UniProt ID | Q8TAU0 |
◆ Recombinant Proteins | ||
NKX2-3-6084M | Recombinant Mouse NKX2-3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKX2-3-10699M | Recombinant Mouse NKX2-3 Protein | +Inquiry |
NKX2-3-6588C | Recombinant Chicken NKX2-3 | +Inquiry |
NKX2-3-301372H | Recombinant Human NKX2-3 protein, GST-tagged | +Inquiry |
NKX2-3-5898H | Recombinant Human NKX2-3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-3 Products
Required fields are marked with *
My Review for All NKX2-3 Products
Required fields are marked with *