Recombinant Human NKX2-3 protein, GST-tagged

Cat.No. : NKX2-3-301372H
Product Overview : Recombinant Human NKX2-3 (19-148 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Asn19-Arg148
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : NLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name NKX2-3 NK2 homeobox 3 [ Homo sapiens ]
Official Symbol NKX2-3
Synonyms NKX2-3; NK2 homeobox 3; NK 2 (Drosophila) homolog C , NK2 transcription factor related, locus 3 (Drosophila) , NKX2C; homeobox protein Nkx-2.3; CSX3; NKX2.3; NKX4 3; homeobox protein NK-2 homolog C; NK2 transcription factor related, locus 3; NK2.3; NKX2C; NKX4-3;
Gene ID 159296
mRNA Refseq NM_145285
Protein Refseq NP_660328
MIM 606727
UniProt ID Q8TAU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-3 Products

Required fields are marked with *

My Review for All NKX2-3 Products

Required fields are marked with *

0
cart-icon
0
compare icon