Recombinant Human NLGN4X, His-tagged
Cat.No. : | NLGN4X-158H |
Product Overview : | Recombinant Human Neuroligin 4, X-Linked/NLGN4X is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln42-Ser676) of Human NLGN4X fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Neuroligin 4, X-Linked (NLGN4X) is a single-pass type I membrane protein that belongs to the type-B carboxylesterase/lipase family. NLGN4X is detected at higher levels in heart and at lower levels in the liver, skeletal muscle, and pancreas. NLGN4X is a putative neuronal cell surface protein involved in cell-cell-interactions. NLGN4X may act as splice site-specific ligands for β-neurexins. It has been shown that NLGN4X is involved in the formation and remodeling of central nervous system synapses. NLGN4X also interacts with discs, large (Drosophila) homolog 4 (DLG4). Defects in NLGN4X have been associated with autism and Asperger syndrome. |
AA Sequence : | QAQYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQF AAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVY IHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEE NVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILA DKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYD IMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKE NPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYV FGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSK YNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTR RSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | NLGN4X neuroligin 4, X-linked [ Homo sapiens ] |
Official Symbol | NLGN4X |
Synonyms | NLGN4X; neuroligin 4, X-linked; neuroligin 4 , NLGN4; neuroligin-4, X-linked; HLNX; KIAA1260; NLGN; neuroligin X; HNLX; HNL4X; NLGN4; ASPGX2; AUTSX2; MGC22376; |
Gene ID | 57502 |
mRNA Refseq | NM_020742 |
Protein Refseq | NP_065793 |
MIM | 300427 |
UniProt ID | Q8N0W4 |
Chromosome Location | Xp22.33 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | NOT carboxylesterase activity; chloride ion binding; neurexin family protein binding; neurexin family protein binding; protein binding; protein homodimerization activity; receptor activity; |
◆ Recombinant Proteins | ||
NLGN4X-731H | Active Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-34H | Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-394H | Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-5039H | Recombinant Human NLGN4X Protein (Gln42-Ser676), C-His tagged | +Inquiry |
NLGN4X-2491H | Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLGN4X-3808HCL | Recombinant Human NLGN4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLGN4X Products
Required fields are marked with *
My Review for All NLGN4X Products
Required fields are marked with *