Recombinant Human NME6 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: NME6-207H
• Product Overview: NME6 MS Standard C13 and N15-labeled recombinant protein (NP_005784) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubMed 10453732]). [supplied by OMIM, Jul 2010]
• Molecular Mass: 22 kDa
• AA Sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens (human) ]
• Official Symbol: NME6
• Synonyms: NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA
• Gene ID: 10201
• mRNA Refseq: NM_005793
• Protein Refseq: NP_005784
• MIM: 608294
• UniProt ID: O75414