Recombinant Human NME6 Protein, GST-tagged
| Cat.No. : | NME6-5934H | 
| Product Overview : | Human NME6 full-length ORF ( AAH01808, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the NM23 gene family (see MIM 156490).[supplied by OMIM | 
| Molecular Mass : | 47.08 kDa | 
| AA Sequence : | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ] | 
| Official Symbol | NME6 | 
| Synonyms | NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA; | 
| Gene ID | 10201 | 
| mRNA Refseq | NM_005793 | 
| Protein Refseq | NP_005784 | 
| MIM | 608294 | 
| UniProt ID | O75414 | 
| ◆ Recombinant Proteins | ||
| NME6-6587HF | Recombinant Full Length Human NME6 Protein, GST-tagged | +Inquiry | 
| NME6-9138Z | Recombinant Zebrafish NME6 | +Inquiry | 
| Nme6-1457M | Recombinant Mouse Nme6 protein, His-tagged | +Inquiry | 
| NME6-1315H | Recombinant Human NME6, GST-tagged | +Inquiry | 
| NME6-1456H | Recombinant Human NME6 protein, His & T7-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NME6-3787HCL | Recombinant Human NME6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NME6 Products
Required fields are marked with *
My Review for All NME6 Products
Required fields are marked with *
  
        
    
      
            