Recombinant Human NME6 Protein, GST-tagged

Cat.No. : NME6-5934H
Product Overview : Human NME6 full-length ORF ( AAH01808, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the NM23 gene family (see MIM 156490).[supplied by OMIM
Molecular Mass : 47.08 kDa
AA Sequence : MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ]
Official Symbol NME6
Synonyms NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA;
Gene ID 10201
mRNA Refseq NM_005793
Protein Refseq NP_005784
MIM 608294
UniProt ID O75414

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME6 Products

Required fields are marked with *

My Review for All NME6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon