Recombinant Human NME9 protein, His-tagged
Cat.No. : | NME9-6754H |
Product Overview : | Recombinant Human NME9 protein(1-151 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-151 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAIKDEALSDEDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NME9 NME family member 9 [ Homo sapiens ] |
Official Symbol | NME9 |
Synonyms | NME9; NME family member 9; NME gene family member 9 , thioredoxin domain containing 6 , TXNDC6; thioredoxin domain-containing protein 6; NM23 H9; TXL 2; thioredoxin-like 2; NME gene family member 9; thioredoxin-like protein 2; thioredoxin domain containing 6; TXL2; TXL-2; TXNDC6; NM23-H9; MGC129586; |
Gene ID | 347736 |
mRNA Refseq | NM_178130 |
Protein Refseq | NP_835231 |
UniProt ID | Q86XW9 |
◆ Recombinant Proteins | ||
NME9-6754H | Recombinant Human NME9 protein, His-tagged | +Inquiry |
NME9-6755H | Recombinant Human NME9 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME9-716HCL | Recombinant Human NME9 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME9 Products
Required fields are marked with *
My Review for All NME9 Products
Required fields are marked with *