Recombinant Human NMI protein, His-GST&Myc-tagged
Cat.No. : | NMI-3338H |
Product Overview : | Recombinant Human NMI protein(Q13287)(62-202aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 62-202aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGS |
Gene Name | NMI N-myc (and STAT) interactor [ Homo sapiens ] |
Official Symbol | NMI |
Synonyms | NMI; N-myc (and STAT) interactor; N-myc-interactor; N-myc interactor; |
Gene ID | 9111 |
mRNA Refseq | NM_004688 |
Protein Refseq | NP_004679 |
MIM | 603525 |
UniProt ID | Q13287 |
◆ Recombinant Proteins | ||
NMI-6589HF | Recombinant Full Length Human NMI Protein, GST-tagged | +Inquiry |
NMI-10746M | Recombinant Mouse NMI Protein | +Inquiry |
NMI-5935H | Recombinant Human NMI Protein, GST-tagged | +Inquiry |
NMI-3057R | Recombinant Rhesus monkey NMI Protein, His-tagged | +Inquiry |
NMI-5682H | Recombinant Human NMI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMI-3785HCL | Recombinant Human NMI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMI Products
Required fields are marked with *
My Review for All NMI Products
Required fields are marked with *
0
Inquiry Basket