Recombinant Human NMNAT1 protein, GST-tagged
| Cat.No. : | NMNAT1-7754H | 
| Product Overview : | Recombinant Human NMNAT1 protein(52-152 aa), fused with N-terminal GST tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E. coli | 
| Tag : | GST | 
| Protein Length : | 52-152 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | GDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVK | 
| Purity : | 85%, by SDS-PAGE. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| Gene Name | NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens ] | 
| Official Symbol | NMNAT1 | 
| Synonyms | NMNAT1; nicotinamide nucleotide adenylyltransferase 1; nicotinamide nucleotide adenylyltransferase; nicotinamide mononucleotide adenylyltransferase 1; NMNAT; PNAT1; NMN adenylyltransferase 1; NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 1; | 
| mRNA Refseq | NM_022787 | 
| Protein Refseq | NP_073624 | 
| MIM | 608700 | 
| UniProt ID | Q9HAN9 | 
| Gene ID | 64802 | 
| ◆ Recombinant Proteins | ||
| NMNAT1-6280H | Recombinant Human NMNAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| NMNAT1-7754H | Recombinant Human NMNAT1 protein, GST-tagged | +Inquiry | 
| NMNAT1-29821TH | Active Recombinant Human NMNAT1 protein, His-tagged | +Inquiry | 
| NMNAT1-1163H | Recombinant Human NMNAT1 Protein, MYC/DDK-tagged | +Inquiry | 
| NMNAT1-77H | Active Recombinant Human NMNAT1 protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NMNAT1-001HCL | Recombinant Human NMNAT1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NMNAT1 Products
Required fields are marked with *
My Review for All NMNAT1 Products
Required fields are marked with *
  
        
    
      
            