Recombinant Human NMNAT1 protein, GST-tagged
Cat.No. : | NMNAT1-7754H |
Product Overview : | Recombinant Human NMNAT1 protein(52-152 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 52-152 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | GDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens ] |
Official Symbol | NMNAT1 |
Synonyms | NMNAT1; nicotinamide nucleotide adenylyltransferase 1; nicotinamide nucleotide adenylyltransferase; nicotinamide mononucleotide adenylyltransferase 1; NMNAT; PNAT1; NMN adenylyltransferase 1; NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 1; |
mRNA Refseq | NM_022787 |
Protein Refseq | NP_073624 |
MIM | 608700 |
UniProt ID | Q9HAN9 |
Gene ID | 64802 |
◆ Recombinant Proteins | ||
NMNAT1-2171HFL | Recombinant Full Length Human NMNAT1 Protein, C-Flag-tagged | +Inquiry |
Nmnat1-4443M | Recombinant Mouse Nmnat1 Protein, Myc/DDK-tagged | +Inquiry |
NMNAT1-29821TH | Active Recombinant Human NMNAT1 protein, His-tagged | +Inquiry |
NMNAT1-26H | Active Recombinant Human NMNAT1, His-tagged | +Inquiry |
NMNAT1-1316H | Recombinant Human NMNAT1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMNAT1-001HCL | Recombinant Human NMNAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMNAT1 Products
Required fields are marked with *
My Review for All NMNAT1 Products
Required fields are marked with *