Recombinant Human NMRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NMRK1-4267H
• Product Overview: C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor.
• Molecular Mass: 23.2 kDa
• AA Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NMRK1 nicotinamide riboside kinase 1 [ Homo sapiens (human) ]
• Official Symbol: NMRK1
• Synonyms: NMRK1; nicotinamide riboside kinase 1; NRK1; C9orf95; bA235O14.2; nicotinamide riboside kinase 1; NRK 1; RNK 1; nicotinic acid riboside kinase 1; nmR-K 1; ribosylnicotinamide kinase 1; ribosylnicotinic acid kinase 1; EC 2.7.1.173; EC 2.7.1.22
• Gene ID: 54981
• mRNA Refseq: NM_017881
• Protein Refseq: NP_060351
• MIM: 608704
• UniProt ID: Q9NWW6