Recombinant Human NMRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NMRK1-4267H
Product Overview : C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor.
Molecular Mass : 23.2 kDa
AA Sequence : MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NMRK1 nicotinamide riboside kinase 1 [ Homo sapiens (human) ]
Official Symbol NMRK1
Synonyms NMRK1; nicotinamide riboside kinase 1; NRK1; C9orf95; bA235O14.2; nicotinamide riboside kinase 1; NRK 1; RNK 1; nicotinic acid riboside kinase 1; nmR-K 1; ribosylnicotinamide kinase 1; ribosylnicotinic acid kinase 1; EC 2.7.1.173; EC 2.7.1.22
Gene ID 54981
mRNA Refseq NM_017881
Protein Refseq NP_060351
MIM 608704
UniProt ID Q9NWW6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMRK1 Products

Required fields are marked with *

My Review for All NMRK1 Products

Required fields are marked with *

0
cart-icon