Recombinant Human NOG protein, His-tagged, Animal-Free
| Cat.No. : | NOG-1993H |
| Product Overview : | Recombinant Human NOG protein(Q13253) with C-terminal His tag was expressed in E. coli and Animal-free. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. |
| Bio-activity : | Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4. |
| Molecular Mass : | The protein has a calculated MW of 24 kDa. The protein migrates as 27 kDa under reducing condition (SDS-PAGE analysis). |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : | >98% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Gene Name | NOG noggin [ Homo sapiens ] |
| Official Symbol | NOG |
| Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
| Gene ID | 9241 |
| mRNA Refseq | NM_005450 |
| Protein Refseq | NP_005441 |
| MIM | 602991 |
| UniProt ID | Q13253 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
