Recombinant Human NOL3 protein, GST-tagged
Cat.No. : | NOL3-1325H |
Product Overview : | Recombinant Human NOL3 protein(1-208 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-208 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
Official Symbol | NOL3 |
Synonyms | NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304; |
Gene ID | 8996 |
mRNA Refseq | NM_001185057 |
Protein Refseq | NP_001171986 |
MIM | 605235 |
UniProt ID | O60936 |
◆ Recombinant Proteins | ||
NOL3-5971H | Recombinant Human NOL3 Protein, GST-tagged | +Inquiry |
NOL3-5124H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
NOL3-5269H | Recombinant Human NOL3 Protein (Met1-Ser208), N-Gst tagged | +Inquiry |
NOL3-48H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
NOL3-1325H | Recombinant Human NOL3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *