Recombinant Human NOP16 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NOP16-6444H
• Product Overview: NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 21.2 kDa
• AA Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NOP16 NOP16 nucleolar protein [ Homo sapiens (human) ]
• Official Symbol: NOP16
• Synonyms: NOP16; NOP16 nucleolar protein homolog (yeast); nucleolar protein 16 homolog (yeast); nucleolar protein 16; HBV pre S2 trans regulated protein 3; HSPC111; HSPC185; hypothetical protein HSPC111; LOC51491; nucleolar protein 16 homolog; HBV pre-S2 trans-regulated protein 3
• Gene ID: 51491
• mRNA Refseq: NM_016391
• Protein Refseq: NP_057475
• MIM: 612861
• UniProt ID: Q9Y3C1