Recombinant Human NOP16 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NOP16-6444H |
Product Overview : | NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 21.2 kDa |
AA Sequence : | MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NOP16 NOP16 nucleolar protein [ Homo sapiens (human) ] |
Official Symbol | NOP16 |
Synonyms | NOP16; NOP16 nucleolar protein homolog (yeast); nucleolar protein 16 homolog (yeast); nucleolar protein 16; HBV pre S2 trans regulated protein 3; HSPC111; HSPC185; hypothetical protein HSPC111; LOC51491; nucleolar protein 16 homolog; HBV pre-S2 trans-regulated protein 3; |
Gene ID | 51491 |
mRNA Refseq | NM_016391 |
Protein Refseq | NP_057475 |
MIM | 612861 |
UniProt ID | Q9Y3C1 |
◆ Recombinant Proteins | ||
NOP16-3067R | Recombinant Rhesus monkey NOP16 Protein, His-tagged | +Inquiry |
Nop16-4459M | Recombinant Mouse Nop16 Protein, Myc/DDK-tagged | +Inquiry |
NOP16-5651HF | Recombinant Full Length Human NOP16 Protein, GST-tagged | +Inquiry |
NOP16-7099H | Recombinant Human NOP16, His-tagged | +Inquiry |
NOP16-6444H | Recombinant Human NOP16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOP16-3765HCL | Recombinant Human NOP16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOP16 Products
Required fields are marked with *
My Review for All NOP16 Products
Required fields are marked with *