Recombinant Human NOP56 Protein, GST-tagged
Cat.No. : | NOP56-5974H |
Product Overview : | Human NOL5A full-length ORF ( AAH04937.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOP56 NOP56 ribonucleoprotein homolog (yeast) [ Homo sapiens ] |
Official Symbol | NOP56 |
Synonyms | NOP56; NOP56 ribonucleoprotein homolog (yeast); NOL5A, nucleolar protein 5A (56kD with KKE/D repeat) , nucleolar protein 5A (56kDa with KKE/D repeat); nucleolar protein 56; SCA36; spinocerebellar ataxia 36; nucleolar protein 5A (56kDa with KKE/D repeat); NOL5A; |
Gene ID | 10528 |
mRNA Refseq | NM_006392 |
Protein Refseq | NP_006383 |
MIM | 614154 |
UniProt ID | O00567 |
◆ Recombinant Proteins | ||
NOP56-3653H | Recombinant Human NOP56 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOP56-495C | Recombinant Cynomolgus Monkey NOP56 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOP56-751C | Recombinant Cynomolgus NOP56 Protein, His-tagged | +Inquiry |
NOP56-29657TH | Recombinant Human NOP56, His-tagged | +Inquiry |
NOP56-5974H | Recombinant Human NOP56 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOP56-3763HCL | Recombinant Human NOP56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOP56 Products
Required fields are marked with *
My Review for All NOP56 Products
Required fields are marked with *