Recombinant Human NOS1 protein(231-310 aa), C-His-tagged

Cat.No. : NOS1-2714H
Product Overview : Recombinant Human NOS1 protein(P29475)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 231-310 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPSKCPRFLKVKN
Gene Name NOS1 nitric oxide synthase 1 (neuronal) [ Homo sapiens ]
Official Symbol NOS1
Synonyms NOS1; nitric oxide synthase 1 (neuronal); NOS; nitric oxide synthase, brain; nNOS; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1; bNOS; IHPS1; N-NOS; NC-NOS;
Gene ID 4842
mRNA Refseq NM_000620
Protein Refseq NP_000611
MIM 163731
UniProt ID P29475

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOS1 Products

Required fields are marked with *

My Review for All NOS1 Products

Required fields are marked with *

0
cart-icon