Recombinant Human NOS1 protein(231-310 aa), C-His-tagged

• Cat.No.: NOS1-2714H
• Product Overview: Recombinant Human NOS1 protein(P29475)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 231-310 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPSKCPRFLKVKN

Gene Information

• Gene Name: NOS1 nitric oxide synthase 1 (neuronal) [ Homo sapiens ]
• Official Symbol: NOS1
• Synonyms: NOS1; nitric oxide synthase 1 (neuronal); NOS; nitric oxide synthase, brain; nNOS; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1; bNOS; IHPS1; N-NOS; NC-NOS
• Gene ID: 4842
• mRNA Refseq: NM_000620
• Protein Refseq: NP_000611
• MIM: 163731
• UniProt ID: P29475