Recombinant Human NOS2 Protein, GST-tagged
Cat.No. : | NOS2-5992H |
Product Overview : | Human NOS2A partial ORF ( NP_000616, 685 a.a. - 794 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ] |
Official Symbol | NOS2 |
Synonyms | NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS; |
Gene ID | 4843 |
mRNA Refseq | NM_000625 |
Protein Refseq | NP_000616 |
MIM | 163730 |
UniProt ID | P35228 |
◆ Recombinant Proteins | ||
NOS2-2901H | Recombinant Human NOS2 protein, His-tagged | +Inquiry |
NOS2-722H | Recombinant Human NOS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nos2-7797M | Recombinant Mouse Nos2 protein, His-tagged | +Inquiry |
NOS2-5992H | Recombinant Human NOS2 Protein, GST-tagged | +Inquiry |
NOS2-4716H | Recombinant Human NOS2 Protein (Met533-Lys696), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS2-3759HCL | Recombinant Human NOS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOS2 Products
Required fields are marked with *
My Review for All NOS2 Products
Required fields are marked with *