Recombinant Human NOS2 Protein, GST-tagged

Cat.No. : NOS2-5992H
Product Overview : Human NOS2A partial ORF ( NP_000616, 685 a.a. - 794 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ]
Official Symbol NOS2
Synonyms NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS;
Gene ID 4843
mRNA Refseq NM_000625
Protein Refseq NP_000616
MIM 163730
UniProt ID P35228

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOS2 Products

Required fields are marked with *

My Review for All NOS2 Products

Required fields are marked with *

0
cart-icon