Recombinant Human NOS2 protein, His-tagged
Cat.No. : | NOS2-2768H |
Product Overview : | Recombinant Human NOS2 protein(240-480 aa), fused to His tag, was expressed in E. coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 240-480 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ] |
Official Symbol | NOS2 |
Synonyms | NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS; |
Gene ID | 4843 |
mRNA Refseq | NM_000625 |
Protein Refseq | NP_000616 |
MIM | 163730 |
UniProt ID | P35228 |
◆ Recombinant Proteins | ||
NOS2-611H | Recombinant Human NOS2, His-Flag-tagged | +Inquiry |
NOS2-298H | Recombinant Human NOS2 | +Inquiry |
NOS2-6137M | Recombinant Mouse NOS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nos2-4461M | Recombinant Mouse Nos2 Protein, Myc/DDK-tagged | +Inquiry |
NOS2-6520C | Recombinant Chicken NOS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS2-3759HCL | Recombinant Human NOS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOS2 Products
Required fields are marked with *
My Review for All NOS2 Products
Required fields are marked with *
0
Inquiry Basket