Recombinant Human NPHP1 protein, GST-tagged

Cat.No. : NPHP1-3643H
Product Overview : Recombinant Human NPHP1 protein(1-48 aa), fused to GST tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-48 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NPHP1 nephronophthisis 1 (juvenile) [ Homo sapiens ]
Official Symbol NPHP1
Synonyms NPHP1; nephronophthisis 1 (juvenile); NPH1; nephrocystin-1; JBTS4; nephrocystin 1; juvenile nephronophthisis 1 protein; SLSN1; FLJ97602;
Gene ID 4867
mRNA Refseq NM_000272
Protein Refseq NP_000263
MIM 607100
UniProt ID O15259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHP1 Products

Required fields are marked with *

My Review for All NPHP1 Products

Required fields are marked with *

0
cart-icon