Recombinant Human NPHP3 protein, GST-tagged
Cat.No. : | NPHP3-1809H |
Product Overview : | Recombinant Human NPHP3 protein(1-131 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-131 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRRGAGAAAGAGPGSLPRGVGAGGLLGASFKSTGSSVPELEYAAAEYERLRKEYEIFRVSKNQELLSMGRREAKLDTENKRLRAELQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NPHP3 nephronophthisis 3 (adolescent) [ Homo sapiens (human) ] |
Official Symbol | NPHP3 |
Synonyms | NPHP3; MKS7; NPH3; RHPD; RHPD1; nephronophthisis 3 (adolescent); nephrocystin-3; Meckel syndrome, type 7 |
Gene ID | 27031 |
mRNA Refseq | NM_153240 |
Protein Refseq | NP_694972 |
MIM | 608002 |
UniProt ID | Q7Z494 |
◆ Recombinant Proteins | ||
NPHP3-6158M | Recombinant Mouse NPHP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPHP3-6028H | Recombinant Human NPHP3 Protein, GST-tagged | +Inquiry |
NPHP3-869H | Recombinant Human NPHP3 | +Inquiry |
NPHP3-10820M | Recombinant Mouse NPHP3 Protein | +Inquiry |
NPHP3-7969Z | Recombinant Zebrafish NPHP3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHP3 Products
Required fields are marked with *
My Review for All NPHP3 Products
Required fields are marked with *