Recombinant Human NPHS1 Protein (23-257 aa), His-tagged

Cat.No. : NPHS1-689H
Product Overview : Recombinant Human NPHS1 Protein (23-257 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-257 aa
Description : Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 29.1 kDa
AA Sequence : QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
Official Symbol NPHS1
Synonyms NPHS1; nephrin; CNF; NPHN;
Gene ID 4868
mRNA Refseq NM_004646
Protein Refseq NP_004637
MIM 602716
UniProt ID O60500

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHS1 Products

Required fields are marked with *

My Review for All NPHS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon