Recombinant Human NPHS1 Protein (23-257 aa), His-tagged
Cat.No. : | NPHS1-689H |
Product Overview : | Recombinant Human NPHS1 Protein (23-257 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-257 aa |
Description : | Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 29.1 kDa |
AA Sequence : | QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ] |
Official Symbol | NPHS1 |
Synonyms | NPHS1; nephrin; CNF; NPHN; |
Gene ID | 4868 |
mRNA Refseq | NM_004646 |
Protein Refseq | NP_004637 |
MIM | 602716 |
UniProt ID | O60500 |
◆ Recombinant Proteins | ||
NPHS1-3581H | Recombinant Human NPHS1 protein, His-tagged | +Inquiry |
NPHS1-3701R | Recombinant Rat NPHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nphs1-6162M | Recombinant Mouse Nphs1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nphs1-718M | Active Recombinant Mouse Nphs1 Protein, His-tagged | +Inquiry |
NPHS1-6031H | Recombinant Human NPHS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHS1 Products
Required fields are marked with *
My Review for All NPHS1 Products
Required fields are marked with *
0
Inquiry Basket