Recombinant Human NPHS1 Protein (23-257 aa), His-tagged

• Cat.No.: NPHS1-689H
• Product Overview: Recombinant Human NPHS1 Protein (23-257 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-257 aa
• Description: Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 29.1 kDa
• AA Sequence: QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
• Official Symbol: NPHS1
• Synonyms: NPHS1; nephrin; CNF; NPHN
• Gene ID: 4868
• mRNA Refseq: NM_004646
• Protein Refseq: NP_004637
• MIM: 602716
• UniProt ID: O60500