Recombinant Human NPHS1 Protein (23-257 aa), His-tagged
| Cat.No. : | NPHS1-689H |
| Product Overview : | Recombinant Human NPHS1 Protein (23-257 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-257 aa |
| Description : | Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ] |
| Official Symbol | NPHS1 |
| Synonyms | NPHS1; nephrin; CNF; NPHN; |
| Gene ID | 4868 |
| mRNA Refseq | NM_004646 |
| Protein Refseq | NP_004637 |
| MIM | 602716 |
| UniProt ID | O60500 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHS1 Products
Required fields are marked with *
My Review for All NPHS1 Products
Required fields are marked with *



