Recombinant Human NPHS1 protein(441-630 aa), N-SUMO & C-His-tagged

Cat.No. : NPHS1-2475H
Product Overview : Recombinant Human NPHS1 protein(O60500)(441-630 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 441-630 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSAEL
Gene Name NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
Official Symbol NPHS1
Synonyms NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor;
Gene ID 4868
mRNA Refseq NM_004646
Protein Refseq NP_004637
MIM 602716
UniProt ID O60500

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHS1 Products

Required fields are marked with *

My Review for All NPHS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon