Recombinant Human NPHS1 protein(441-630 aa), N-SUMO & C-His-tagged
| Cat.No. : | NPHS1-2475H |
| Product Overview : | Recombinant Human NPHS1 protein(O60500)(441-630 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 441-630 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSAEL |
| Gene Name | NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ] |
| Official Symbol | NPHS1 |
| Synonyms | NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor; |
| Gene ID | 4868 |
| mRNA Refseq | NM_004646 |
| Protein Refseq | NP_004637 |
| MIM | 602716 |
| UniProt ID | O60500 |
| ◆ Recombinant Proteins | ||
| NPHS1-6031H | Recombinant Human NPHS1 Protein, GST-tagged | +Inquiry |
| NPHS1-689H | Recombinant Human NPHS1 Protein (23-257 aa), His-tagged | +Inquiry |
| NPHS1-5044H | Recombinant Human NPHS1 protein, His-tagged | +Inquiry |
| NPHS1-29301TH | Recombinant Human NPHS1 | +Inquiry |
| NPHS1-5045H | Recombinant Human NPHS1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHS1 Products
Required fields are marked with *
My Review for All NPHS1 Products
Required fields are marked with *
