Recombinant Human NPL Protein, GST-tagged
Cat.No. : | NPL-6034H |
Product Overview : | Human NPL full-length ORF ( AAH58003.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | N-acetylneuraminate pyruvate lyase (EC 4.1.3.3) controls the cellular concentration of sialic acid by catalyzing the conversion of sialic acid into acylmannosamines and pyruvate (Wu et al., 2005 [PubMed 16147865]).[supplied by OMIM |
Molecular Mass : | 53.2 kDa |
AA Sequence : | MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEFCIQRFINFVVKLENSKLKVSKNQRTLPLGTTNFPFLH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPL N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) [ Homo sapiens ] |
Official Symbol | NPL |
Synonyms | NPL; N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase); C1orf13, chromosome 1 open reading frame 13; N-acetylneuraminate lyase; DHDPS1; dihydrodipicolinate synthetase homolog 1 (E. coli); NPL1; NALase; sialic acid aldolase; sialate-pyruvate lyase; N-acetylneuraminic acid aldolase; dihydrodipicolinate synthetase homolog 1; NAL; C112; C1orf13; MGC61869; MGC149582; |
Gene ID | 80896 |
mRNA Refseq | NM_001200050 |
Protein Refseq | NP_001186979 |
MIM | 611412 |
UniProt ID | Q9BXD5 |
◆ Recombinant Proteins | ||
NPL-6034H | Recombinant Human NPL Protein, GST-tagged | +Inquiry |
NPL-10824M | Recombinant Mouse NPL Protein | +Inquiry |
NPL-981H | Recombinant Human NPL, His-tagged | +Inquiry |
NPL-4044R | Recombinant Rat NPL Protein | +Inquiry |
NPL-1057H | Recombinant Human NPL | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPL-3741HCL | Recombinant Human NPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPL Products
Required fields are marked with *
My Review for All NPL Products
Required fields are marked with *