Recombinant Human NPY2R protein, His-SUMO-tagged
Cat.No. : | NPY2R-8854H |
Product Overview : | Recombinant Human NPY2R protein(P49146)(326-381aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 326-381a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV |
Gene Name | NPY2R neuropeptide Y receptor Y2 [ Homo sapiens ] |
Official Symbol | NPY2R |
Synonyms | NPY2R; neuropeptide Y receptor Y2; neuropeptide Y receptor type 2; Y2 receptor; NPY-Y2 receptor; NPY2-R; |
Gene ID | 4887 |
mRNA Refseq | NM_000910 |
Protein Refseq | NP_000901 |
MIM | 162642 |
UniProt ID | P49146 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *