Recombinant Human NPY5R protein, GST-tagged
Cat.No. : | NPY5R-301329H |
Product Overview : | Recombinant Human NPY5R (1-42 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Tyr42 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NPY5R neuropeptide Y receptor Y5 [ Homo sapiens ] |
Official Symbol | NPY5R |
Synonyms | NPYR5; NPY5-R; NPYY5-R |
Gene ID | 4889 |
mRNA Refseq | NM_006174.2 |
Protein Refseq | NP_006165.1 |
MIM | 602001 |
UniProt ID | Q15761 |
◆ Recombinant Proteins | ||
NPY5R-2908R | Recombinant Rhesus Macaque NPY5R Protein, His (Fc)-Avi-tagged | +Inquiry |
NPY5R-301329H | Recombinant Human NPY5R protein, GST-tagged | +Inquiry |
NPY5R-6060H | Recombinant Human NPY5R Protein | +Inquiry |
NPY5R-3089R | Recombinant Rhesus monkey NPY5R Protein, His-tagged | +Inquiry |
NPY5R-6663HF | Recombinant Full Length Human NPY5R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPY5R-1215HCL | Recombinant Human NPY5R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY5R Products
Required fields are marked with *
My Review for All NPY5R Products
Required fields are marked with *