Recombinant Human NR1H4 protein, His-tagged

• Cat.No.: NR1H4-7867H
• Product Overview: Recombinant Human NR1H4 protein(1-121 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-121 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NR1H4 nuclear receptor subfamily 1, group H, member 4 [ Homo sapiens ]
• Official Symbol: NR1H4
• Synonyms: NR1H4; nuclear receptor subfamily 1, group H, member 4; bile acid receptor; FXR; HRR 1; HRR1; RIP14; farnesol receptor HRR-1; RXR-interacting protein 14; farnesoid X nuclear receptor; farnesoid X-activated receptor; retinoid X receptor-interacting protein 14; BAR; HRR-1; MGC163445
• Gene ID: 9971
• mRNA Refseq: NM_001206977
• Protein Refseq: NP_001193906
• MIM: 603826
• UniProt ID: Q96RI1