Recombinant Human NR1H4 protein, His-tagged

Cat.No. : NR1H4-7867H
Product Overview : Recombinant Human NR1H4 protein(1-121 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-121 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name NR1H4 nuclear receptor subfamily 1, group H, member 4 [ Homo sapiens ]
Official Symbol NR1H4
Synonyms NR1H4; nuclear receptor subfamily 1, group H, member 4; bile acid receptor; FXR; HRR 1; HRR1; RIP14; farnesol receptor HRR-1; RXR-interacting protein 14; farnesoid X nuclear receptor; farnesoid X-activated receptor; retinoid X receptor-interacting protein 14; BAR; HRR-1; MGC163445;
Gene ID 9971
mRNA Refseq NM_001206977
Protein Refseq NP_001193906
MIM 603826
UniProt ID Q96RI1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NR1H4 Products

Required fields are marked with *

My Review for All NR1H4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon