Recombinant Human NR1I2 Protein, His-SUMO/MYC-tagged
Cat.No. : | NR1I2-1300H |
Product Overview : | Recombinant Human NR1I2 Protein (1-434aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-434 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 69.8 kDa |
AA Sequence : | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | NR1I2 nuclear receptor subfamily 1 group I member 2 [ Homo sapiens (human) ] |
Official Symbol | NR1I2 |
Synonyms | BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq |
Gene ID | 8856 |
mRNA Refseq | NM_003889.3 |
Protein Refseq | NP_003880.3 |
MIM | 603065 |
UniProt ID | O75469 |
◆ Recombinant Proteins | ||
NR1I2-1356H | Recombinant Human NR1I2, His-tagged | +Inquiry |
NR1I2-1896H | Recombinant Human NR1I2, Ligand Binding Domain | +Inquiry |
NR1I2-5691Z | Recombinant Zebrafish NR1I2 | +Inquiry |
NR1I2-1537H | Recombinant Human NR1I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR1I2-1095H | Active Recombinant Human Nuclear Receptor Subfamily 1, Group I, Member 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR1I2-3718HCL | Recombinant Human NR1I2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR1I2 Products
Required fields are marked with *
My Review for All NR1I2 Products
Required fields are marked with *
0
Inquiry Basket