Recombinant Human NR1I2 Protein, His-SUMO/MYC-tagged
| Cat.No. : | NR1I2-1300H |
| Product Overview : | Recombinant Human NR1I2 Protein (1-434aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-434 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 69.8 kDa |
| AA Sequence : | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | NR1I2 nuclear receptor subfamily 1 group I member 2 [ Homo sapiens (human) ] |
| Official Symbol | NR1I2 |
| Synonyms | BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq |
| Gene ID | 8856 |
| mRNA Refseq | NM_003889.3 |
| Protein Refseq | NP_003880.3 |
| MIM | 603065 |
| UniProt ID | O75469 |
| ◆ Recombinant Proteins | ||
| NR1I2-0774H | Recombinant Human NR1I2 Protein (S130-S434), His tagged | +Inquiry |
| NR1I2-10859M | Recombinant Mouse NR1I2 Protein | +Inquiry |
| NR1I2-8489H | Recombinant Human NR1I2, His-tagged | +Inquiry |
| NR1I2-1300H | Recombinant Human NR1I2 Protein, His-SUMO/MYC-tagged | +Inquiry |
| NR1I2-1095H | Active Recombinant Human Nuclear Receptor Subfamily 1, Group I, Member 2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR1I2-3718HCL | Recombinant Human NR1I2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR1I2 Products
Required fields are marked with *
My Review for All NR1I2 Products
Required fields are marked with *
