Recombinant Human NR2F6 protein

Cat.No. : NR2F6-5743H
Product Overview : Recombinant Human NR2F6 protein(P10588)(1-404aa) was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-404a.a.
Tag : Non
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.1 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Gene Name NR2F6 nuclear receptor subfamily 2, group F, member 6 [ Homo sapiens ]
Official Symbol NR2F6
Synonyms NR2F6; nuclear receptor subfamily 2, group F, member 6; ERBAL2; nuclear receptor subfamily 2 group F member 6; EAR 2; ERBA-related gene-2; V-erbA-related protein 2; nuclear receptor V-erbA-related; v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2; EAR2; EAR-2;
Gene ID 2063
mRNA Refseq NM_005234
Protein Refseq NP_005225
MIM 132880
UniProt ID P10588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2F6 Products

Required fields are marked with *

My Review for All NR2F6 Products

Required fields are marked with *

0
cart-icon