Recombinant Human NR3C1 protein, His-GST-tagged
Cat.No. : | NR3C1-3290H |
Product Overview : | Recombinant Human NR3C1 protein(P04150)(521-777aa), fused to N-terminal His-GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 521-777aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 59.8 kDa |
AA Sequence : | VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NR3C1 nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) [ Homo sapiens ] |
Official Symbol | NR3C1 |
Synonyms | NR3C1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); GRL, nuclear receptor subfamily 3, group C, member 1; glucocorticoid receptor; GR; glucocorticoid nuclear receptor variant 1; GCR; GRL; GCCR; |
Gene ID | 2908 |
mRNA Refseq | NM_000176 |
Protein Refseq | NP_000167 |
UniProt ID | P04150 |
◆ Recombinant Proteins | ||
NR3C1-3291H | Recombinant Human NR3C1 protein, His-Trx-tagged | +Inquiry |
NR3C1-4216H | Recombinant Human NR3C1 Protein (Val271-Lys777), N-His tagged | +Inquiry |
NR3C1-3290H | Recombinant Human NR3C1 protein, His-GST-tagged | +Inquiry |
Nr3c1-7651M | Recombinant Mouse Nr3c1 protein, His-tagged | +Inquiry |
NR3C1-2750H | Recombinant Human NR3C1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR3C1-1218HCL | Recombinant Human NR3C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR3C1 Products
Required fields are marked with *
My Review for All NR3C1 Products
Required fields are marked with *
0
Inquiry Basket