Recombinant Human NR3C1 protein, His-SUMO-tagged
| Cat.No. : | NR3C1-4633H |
| Product Overview : | Recombinant Human NR3C1 protein(P04150)(521-777aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 521-777a.a. |
| Tag : | His&SUMO |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK |
| Gene Name | NR3C1 nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) [ Homo sapiens ] |
| Official Symbol | NR3C1 |
| Synonyms | NR3C1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); GRL, nuclear receptor subfamily 3, group C, member 1; glucocorticoid receptor; GR; glucocorticoid nuclear receptor variant 1; GCR; GRL; GCCR; |
| Gene ID | 2908 |
| mRNA Refseq | NM_000176 |
| Protein Refseq | NP_000167 |
| UniProt ID | P04150 |
| ◆ Recombinant Proteins | ||
| NR3C1-104H | Recombinant Human Glucocorticoid receptor LBD/Hsp90 complex, GST-tagged | +Inquiry |
| NR3C1-1044H | Recombinant Human NR3C1 protein, His-tagged | +Inquiry |
| Nr3c1-7165R | Recombinant Rat Nr3c1 protein, His & GST-tagged | +Inquiry |
| NR3C1-28739TH | Recombinant Human NR3C1, His-tagged | +Inquiry |
| NR3C1-2867Z | Recombinant Zebrafish NR3C1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR3C1-380HKCL | Human NR3C1 Knockdown Cell Lysate | +Inquiry |
| NR3C1-1218HCL | Recombinant Human NR3C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR3C1 Products
Required fields are marked with *
My Review for All NR3C1 Products
Required fields are marked with *
