Recombinant Human NRARP Protein, GST-tagged
| Cat.No. : | NRARP-6105H |
| Product Overview : | Human NRARP full-length ORF ( NP_001004354.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG). |
| Molecular Mass : | 38.9 kDa |
| AA Sequence : | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens ] |
| Official Symbol | NRARP |
| Synonyms | NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598; |
| Gene ID | 441478 |
| mRNA Refseq | NM_001004354 |
| Protein Refseq | NP_001004354 |
| UniProt ID | Q7Z6K4 |
| ◆ Recombinant Proteins | ||
| NRARP-10879M | Recombinant Mouse NRARP Protein | +Inquiry |
| NRARP-1656H | Recombinant Human NRARP | +Inquiry |
| NRARP-3250M | Recombinant Mouse NRARP protein, His-tagged | +Inquiry |
| NRARP-1362H | Recombinant Human NRARP protein, His-tagged | +Inquiry |
| NRARP-6195M | Recombinant Mouse NRARP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRARP-3703HCL | Recombinant Human NRARP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRARP Products
Required fields are marked with *
My Review for All NRARP Products
Required fields are marked with *
