Recombinant Human NRARP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NRARP-6337H |
Product Overview : | NRARP MS Standard C13 and N15-labeled recombinant protein (NP_001004354) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Diseases associated with NRARP include Exudative Vitreoretinopathy 1. Among its related pathways are Notch Signaling Pathway (WikiPathways). An important paralog of this gene is ANKRD6. |
Molecular Mass : | 12.5 kDa |
AA Sequence : | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens (human) ] |
Official Symbol | NRARP |
Synonyms | NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598; |
Gene ID | 441478 |
mRNA Refseq | NM_001004354 |
Protein Refseq | NP_001004354 |
UniProt ID | Q7Z6K4 |
◆ Recombinant Proteins | ||
NRARP-6105H | Recombinant Human NRARP Protein, GST-tagged | +Inquiry |
NRARP-6337H | Recombinant Human NRARP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NRARP-1362H | Recombinant Human NRARP, His-tagged | +Inquiry |
NRARP-6749HF | Recombinant Full Length Human NRARP Protein, GST-tagged | +Inquiry |
Nrarp-1606M | Recombinant Mouse Nrarp protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRARP-3703HCL | Recombinant Human NRARP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRARP Products
Required fields are marked with *
My Review for All NRARP Products
Required fields are marked with *
0
Inquiry Basket