Recombinant Human NRARP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NRARP-6337H |
| Product Overview : | NRARP MS Standard C13 and N15-labeled recombinant protein (NP_001004354) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Diseases associated with NRARP include Exudative Vitreoretinopathy 1. Among its related pathways are Notch Signaling Pathway (WikiPathways). An important paralog of this gene is ANKRD6. |
| Molecular Mass : | 12.5 kDa |
| AA Sequence : | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens (human) ] |
| Official Symbol | NRARP |
| Synonyms | NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598; |
| Gene ID | 441478 |
| mRNA Refseq | NM_001004354 |
| Protein Refseq | NP_001004354 |
| UniProt ID | Q7Z6K4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRARP Products
Required fields are marked with *
My Review for All NRARP Products
Required fields are marked with *
