Recombinant Human NRG2, GST-tagged
| Cat.No. : | NRG2-267H |
| Product Overview : | Recombinant Human NRG2 ( NP_004874, 116 aa - 215 aa), fused with GST-tag at N-terminal was expressed in Wheat germ. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the ERBB family of receptors, this protein induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1, another member of the neuregulin family of ligands. The products of these genes mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. This gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease. Alternative transcript variants encoding distinct isoforms have been described. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
| Gene Name | NRG2 neuregulin 2 [ Homo sapiens ] |
| Official Symbol | NRG2 |
| Synonyms | NRG2; neuregulin 2; pro-neuregulin-2, membrane-bound isoform; divergent of neuregulin 1; Don 1; HRG2; neural and thymus derived activator for ErbB kinases; NTAK; pro-NRG2; divergent of neuregulin-1; neural- and thymus-derived activator for ErbB kinases; DON1; |
| Gene ID | 9542 |
| mRNA Refseq | NM_004883 |
| Protein Refseq | NP_004874 |
| MIM | 603818 |
| UniProt ID | O14511 |
| Chromosome Location | 5q23-q33 |
| Pathway | Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; GRB2 events in ERBB2 signaling, organism-specific biosystem; |
| Function | ErbB-3 class receptor binding; epidermal growth factor receptor binding; epidermal growth factor-activated receptor activity; growth factor activity; receptor binding; |
| ◆ Recombinant Proteins | ||
| NRG2-693H | Recombinant Human NRG2 Protein (112-405 aa), His-SUMO-tagged | +Inquiry |
| NRG2-267H | Recombinant Human NRG2, GST-tagged | +Inquiry |
| NRG2-3739R | Recombinant Rat NRG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NRG2-1741H | Recombinant Human NRG2 Protein (112-405 aa), His-tagged | +Inquiry |
| NRG2-2695H | Recombinant Human Neuregulin 2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG2 Products
Required fields are marked with *
My Review for All NRG2 Products
Required fields are marked with *
