Recombinant Human NRG4 protein, GST-tagged
| Cat.No. : | NRG4-1365H |
| Product Overview : | Recombinant Human NRG4 protein(1-62 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | January 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-62 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| AA Sequence : | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | NRG4 |
| Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
| Gene ID | 145957 |
| mRNA Refseq | NM_138573 |
| Protein Refseq | NP_612640 |
| MIM | 610894 |
| UniProt ID | Q8WWG1 |
| ◆ Recombinant Proteins | ||
| NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
| NRG4-452H | Recombinant Human NRG4 protein(Pro2-Phe62) | +Inquiry |
| NRG4-3043H | Recombinant Human NRG4 protein, His-tagged | +Inquiry |
| NRG4-365H | Recombinant Human NRG4 Protein, His/GST-tagged | +Inquiry |
| NRG4-10888M | Recombinant Mouse NRG4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
