Recombinant Human NRG4 Protein, His-tagged
| Cat.No. : | NRG4-825H |
| Product Overview : | Recombinant human NRG4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 115 |
| Description : | The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation. |
| Form : | Lyophilized |
| Molecular Mass : | 8.6 kDa |
| AA Sequence : | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
| Purity : | > 98% |
| Applications : | Migration Assay; |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | NRG4 neuregulin 4 [ Homo sapiens (human) ] |
| Official Symbol | NRG4 |
| Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
| Gene ID | 145957 |
| mRNA Refseq | NM_138573 |
| Protein Refseq | NP_612640 |
| MIM | 610894 |
| UniProt ID | Q8WWG1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
