Recombinant Human NRG4 Protein, His-tagged
Cat.No. : | NRG4-825H |
Product Overview : | Recombinant human NRG4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 115 |
Description : | The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation. |
Form : | Lyophilized |
Molecular Mass : | 8.6 kDa |
AA Sequence : | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
Purity : | > 98% |
Applications : | Migration Assay; |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | NRG4 neuregulin 4 [ Homo sapiens (human) ] |
Official Symbol | NRG4 |
Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
Gene ID | 145957 |
mRNA Refseq | NM_138573 |
Protein Refseq | NP_612640 |
MIM | 610894 |
UniProt ID | Q8WWG1 |
◆ Recombinant Proteins | ||
NRG4-525H | Active Recombinant Human NRG4 | +Inquiry |
Nrg4-1861R | Recombinant Rat Nrg4 Protein, His-tagged | +Inquiry |
NRG4-452H | Recombinant Human NRG4 protein(Pro2-Phe62) | +Inquiry |
Nrg4-01M | Active Recombinant Mouse Nrg4 Protein, GST-tagged | +Inquiry |
NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
◆ Native Proteins | ||
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *