Recombinant Human NRGN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NRGN-4185H
Product Overview : NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Molecular Mass : 7.6 kDa
AA Sequence : MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NRGN neurogranin [ Homo sapiens (human) ]
Official Symbol NRGN
Synonyms NRGN; RC3; hng; neurogranin (protein kinase C substrate, RC3); neurogranin; ng; calmodulin-binding protein; protein kinase C substrate
Gene ID 4900
mRNA Refseq NM_006176
Protein Refseq NP_006167
MIM 602350
UniProt ID Q92686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRGN Products

Required fields are marked with *

My Review for All NRGN Products

Required fields are marked with *

0
cart-icon
0
compare icon