Recombinant Human NRGN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NRGN-4185H |
Product Overview : | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. |
Molecular Mass : | 7.6 kDa |
AA Sequence : | MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NRGN neurogranin [ Homo sapiens (human) ] |
Official Symbol | NRGN |
Synonyms | NRGN; RC3; hng; neurogranin (protein kinase C substrate, RC3); neurogranin; ng; calmodulin-binding protein; protein kinase C substrate |
Gene ID | 4900 |
mRNA Refseq | NM_006176 |
Protein Refseq | NP_006167 |
MIM | 602350 |
UniProt ID | Q92686 |
◆ Recombinant Proteins | ||
NRGN-2511H | Recombinant Human NRGN Protein, His-tagged | +Inquiry |
NRGN-113HFL | Active Recombinant Full Length Human NRGN Protein, C-Flag-tagged | +Inquiry |
NRGN-241H | Recombinant Human NRGN protein, His-tagged | +Inquiry |
NRGN-1547H | Recombinant Human NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-3740R | Recombinant Rat NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRGN-3696HCL | Recombinant Human NRGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRGN Products
Required fields are marked with *
My Review for All NRGN Products
Required fields are marked with *