Recombinant Human NRIP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NRIP3-4140H
• Product Overview: NRIP3 MS Standard C13 and N15-labeled recombinant protein (NP_065696) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NRIP3 (Nuclear Receptor Interacting Protein 3) is a Protein Coding gene. Diseases associated with NRIP3 include Arthrogryposis, Distal, Type 1B and Arthrogryposis, Distal, Type 2A. Gene Ontology (GO) annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is NRIP2.
• Molecular Mass: 27 kDa
• AA Sequence: MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NRIP3 nuclear receptor interacting protein 3 [ Homo sapiens (human) ]
• Official Symbol: NRIP3
• Synonyms: NRIP3; nuclear receptor interacting protein 3; C11orf14, chromosome 11 open reading frame 14; nuclear receptor-interacting protein 3; sarcoma antigen NY-SAR-105; C11orf14; NY-SAR-105
• Gene ID: 56675
• mRNA Refseq: NM_020645
• Protein Refseq: NP_065696
• MIM: 613125
• UniProt ID: Q9NQ35