Recombinant Human NRIP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NRIP3-4140H
Product Overview : NRIP3 MS Standard C13 and N15-labeled recombinant protein (NP_065696) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NRIP3 (Nuclear Receptor Interacting Protein 3) is a Protein Coding gene. Diseases associated with NRIP3 include Arthrogryposis, Distal, Type 1B and Arthrogryposis, Distal, Type 2A. Gene Ontology (GO) annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is NRIP2.
Molecular Mass : 27 kDa
AA Sequence : MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NRIP3 nuclear receptor interacting protein 3 [ Homo sapiens (human) ]
Official Symbol NRIP3
Synonyms NRIP3; nuclear receptor interacting protein 3; C11orf14, chromosome 11 open reading frame 14; nuclear receptor-interacting protein 3; sarcoma antigen NY-SAR-105; C11orf14; NY-SAR-105;
Gene ID 56675
mRNA Refseq NM_020645
Protein Refseq NP_065696
MIM 613125
UniProt ID Q9NQ35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRIP3 Products

Required fields are marked with *

My Review for All NRIP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon