Recombinant Human NSD1 protein, His-tagged

Cat.No. : NSD1-2813H
Product Overview : Recombinant Human NSD1 protein(341-630 aa), fused to His tag, was expressed in E. coli.
Availability November 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 341-630 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETPQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NSD1 nuclear receptor binding SET domain protein 1 [ Homo sapiens ]
Official Symbol NSD1
Synonyms NSD1; nuclear receptor binding SET domain protein 1; Sotos syndrome , STO; histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; ARA267; FLJ22263; KMT3B; H3-K36-HMTase; H4-K20-HMTase; lysine N-methyltransferase 3B; NR-binding SET domain-containing protein; androgen receptor-associated coregulator 267; androgen receptor coactivator 267 kDa protein; androgen receptor-associated protein of 267 kDa; nuclear receptor-binding SET domain-containing protein 1; STO; SOTOS; FLJ10684; FLJ44628; DKFZp666C163;
Gene ID 64324
mRNA Refseq NM_022455
Protein Refseq NP_071900
MIM 606681
UniProt ID Q96L73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NSD1 Products

Required fields are marked with *

My Review for All NSD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon