Recombinant Human NSD1 protein, His-tagged
Cat.No. : | NSD1-2813H |
Product Overview : | Recombinant Human NSD1 protein(341-630 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341-630 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETPQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NSD1 nuclear receptor binding SET domain protein 1 [ Homo sapiens ] |
Official Symbol | NSD1 |
Synonyms | NSD1; nuclear receptor binding SET domain protein 1; Sotos syndrome , STO; histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; ARA267; FLJ22263; KMT3B; H3-K36-HMTase; H4-K20-HMTase; lysine N-methyltransferase 3B; NR-binding SET domain-containing protein; androgen receptor-associated coregulator 267; androgen receptor coactivator 267 kDa protein; androgen receptor-associated protein of 267 kDa; nuclear receptor-binding SET domain-containing protein 1; STO; SOTOS; FLJ10684; FLJ44628; DKFZp666C163; |
Gene ID | 64324 |
mRNA Refseq | NM_022455 |
Protein Refseq | NP_071900 |
MIM | 606681 |
UniProt ID | Q96L73 |
◆ Recombinant Proteins | ||
NSD1-002H | Recombinant Human NSD1 Protein, GST-tagged | +Inquiry |
NSD1-035H | Recombinant Human NSD1 Protein, GST-tagged | +Inquiry |
NSD1-82H | Recombinant Human NSD1, GST-tagged | +Inquiry |
NSD1-03H | Active Recombinant Human NSD1 protein, GST-tagged | +Inquiry |
NSD1-143H | Recombinant Human NSD1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSD1 Products
Required fields are marked with *
My Review for All NSD1 Products
Required fields are marked with *