Recombinant Human NSMCE1, His-tagged
Cat.No. : | NSMCE1-29732TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-266 of Human NSMCE1 With N terminal His tag; 34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-266 a.a. |
Description : | NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double strand breaks. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 85 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHC YKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTED DGRPIYALVNLATTSISKMATDFAENELDLFRKALELI IDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFV QNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN ICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH |
Full Length : | Full L. |
Gene Name | NSMCE1 non-SMC element 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NSMCE1 |
Synonyms | NSMCE1; non-SMC element 1 homolog (S. cerevisiae); non-structural maintenance of chromosomes element 1 homolog; NSE1; |
Gene ID | 197370 |
mRNA Refseq | NM_145080 |
Protein Refseq | NP_659547 |
Uniprot ID | Q8WV22 |
Chromosome Location | 16p12.1 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
NSMCE1-672Z | Recombinant Zebrafish NSMCE1 | +Inquiry |
NSMCE1-4094R | Recombinant Rat NSMCE1 Protein | +Inquiry |
NSMCE1-15875H | Recombinant Human NSMCE1, His-tagged | +Inquiry |
NSMCE1-6222M | Recombinant Mouse NSMCE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NSMCE1-10915M | Recombinant Mouse NSMCE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSMCE1-1224HCL | Recombinant Human NSMCE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSMCE1 Products
Required fields are marked with *
My Review for All NSMCE1 Products
Required fields are marked with *
0
Inquiry Basket