Recombinant Human NSUN7 protein, GST-tagged

Cat.No. : NSUN7-8866H
Product Overview : Recombinant Human NSUN7 protein(332-475 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 332-475 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : DPDLKTLFTKIGCKNIEILHEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYEQLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYSGTLLRQCL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name NSUN7 NOP2/Sun domain family, member 7 [ Homo sapiens ]
Official Symbol NSUN7
Synonyms NSUN7; NOP2/Sun domain family, member 7; NOL1/NOP2/Sun domain family, member 7; putative methyltransferase NSUN7; FLJ14001; NOL1/NOP2/Sun domain family member 7;
Gene ID 79730
mRNA Refseq NM_024677
Protein Refseq NP_078953
UniProt ID Q8NE18

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NSUN7 Products

Required fields are marked with *

My Review for All NSUN7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon