Recombinant Human NT5C protein, His&Myc-tagged

Cat.No. : NT5C-4633H
Product Overview : Recombinant Human NT5C protein(Q8TCD5)(1-201aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-201a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Gene Name NT5C 5, 3-nucleotidase, cytosolic [ Homo sapiens ]
Official Symbol NT5C
Synonyms NT5C; 5, 3-nucleotidase, cytosolic; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C , UMPH2, uridine 5 prime monophosphate hydrolase 2; 5(3)-deoxyribonucleotidase, cytosolic type; cdN; DNT 1; dNT 1; DNT1; PN I; deoxy-5-nucleotidase 1; cytosolic 5,3-pyrimidine nucleotidase; uridine 5-prime monophosphate hydrolase 2; uridine 5-monophosphate phosphohydrolase 2; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C; DNT; P5N2; PN-I; PN-II; UMPH2; dNT-1;
Gene ID 30833
mRNA Refseq NM_001252377
Protein Refseq NP_001239306
MIM 191720
UniProt ID Q8TCD5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NT5C Products

Required fields are marked with *

My Review for All NT5C Products

Required fields are marked with *

0
cart-icon