Recombinant Human NT5C2 protein, GST-tagged
| Cat.No. : | NT5C2-258H |
| Product Overview : | Recombinant Human NT5C2 (1 a.a. - 561 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-561 a.a. |
| Description : | Purine 5-prime-nucleotidase (EC 3.1.3.5) preferentially hydrolyzes inosine 5-prime-monophosphate (IMP) and other purine nucleotides, and is allosterically activated by various compounds, including ATP. The enzyme is exclusively located in the cytoplasmic matrix of cells and may have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 87.45 kDa |
| AA Sequence : | MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVE RLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERF YILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKY VVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPEL AQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLF ASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLT RSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | NT5C2 5'-nucleotidase, cytosolic II [ Homo sapiens ] |
| Official Symbol | NT5C2 |
| Synonyms | GMP; NT5B; PNT5; SPG45; SPG65; cN-II; cytosolic purine 5'-nucleotidase; 5'-nucleotidase (purine), cytosolic type B; IMP-specific 5'-NT; cytosolic 5'-nucleotidase II; purine 5' nucleotidase |
| Gene ID | 22978 |
| mRNA Refseq | NM_012229 |
| Protein Refseq | NP_036361 |
| MIM | 600417 |
| UniProt ID | P49902 |
| Chromosome Location | 10q24.32 |
| Pathway | Abacavir metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem |
| Function | 5'-nucleotidase activity; 5'-nucleotidase activity; nucleoside phosphotransferase activity |
| ◆ Recombinant Proteins | ||
| NT5C2-29445TH | Recombinant Human NT5C2, His-tagged | +Inquiry |
| NT5C2-3473H | Recombinant Human NT5C2 protein, His-tagged | +Inquiry |
| NT5C2-257H | Recombinant Human NT5C2 protein, MYC/DDK-tagged | +Inquiry |
| NT5C2-258H | Recombinant Human NT5C2 protein, GST-tagged | +Inquiry |
| Nt5c2-4515M | Recombinant Mouse Nt5c2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C2 Products
Required fields are marked with *
My Review for All NT5C2 Products
Required fields are marked with *
