Recombinant Human NT5C2 protein, GST-tagged
Cat.No. : | NT5C2-258H |
Product Overview : | Recombinant Human NT5C2 (1 a.a. - 561 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-561 a.a. |
Description : | Purine 5-prime-nucleotidase (EC 3.1.3.5) preferentially hydrolyzes inosine 5-prime-monophosphate (IMP) and other purine nucleotides, and is allosterically activated by various compounds, including ATP. The enzyme is exclusively located in the cytoplasmic matrix of cells and may have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 87.45 kDa |
AA Sequence : | MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVE RLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERF YILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKY VVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPEL AQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLF ASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLT RSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NT5C2 5'-nucleotidase, cytosolic II [ Homo sapiens ] |
Official Symbol | NT5C2 |
Synonyms | GMP; NT5B; PNT5; SPG45; SPG65; cN-II; cytosolic purine 5'-nucleotidase; 5'-nucleotidase (purine), cytosolic type B; IMP-specific 5'-NT; cytosolic 5'-nucleotidase II; purine 5' nucleotidase |
Gene ID | 22978 |
mRNA Refseq | NM_012229 |
Protein Refseq | NP_036361 |
MIM | 600417 |
UniProt ID | P49902 |
Chromosome Location | 10q24.32 |
Pathway | Abacavir metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem |
Function | 5'-nucleotidase activity; 5'-nucleotidase activity; nucleoside phosphotransferase activity |
◆ Recombinant Proteins | ||
NT5C2-256H | Recombinant Human NT5C2 protein, MYC/DDK-tagged | +Inquiry |
NT5C2-29443TH | Recombinant Human NT5C2, T7 -tagged | +Inquiry |
NT5C2-258H | Recombinant Human NT5C2 protein, GST-tagged | +Inquiry |
NT5C2-2490HM | Recombinant Human NT5C2 Protein (Mutant), N-6×His-tagged | +Inquiry |
NT5C2-6902HFL | Recombinant Full Length Human NT5C2 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C2 Products
Required fields are marked with *
My Review for All NT5C2 Products
Required fields are marked with *